PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04539.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 885aa    MW: 97856.4 Da    PI: 9.8882
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04539.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.42.6e-16471518148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+WT+eEd+ lv + +++G+g+W++++++ g+ R+ k+c++rw +yl
  Zmw_sc04539.1.g00050.1.am.mk 471 KGPWTPEEDLVLVSYLQEHGPGNWRAVPARTGLMRCSKSCRLRWTNYL 518
                                   79********************************************97 PP

2Myb_DNA-binding48.32.4e-15524569148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   rg++T +E++l+v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Zmw_sc04539.1.g00050.1.am.mk 524 RGNFTDQEEKLIVHLQALLGNR-WAAIASYLP-ERTDNDIKNFWNTHL 569
                                   89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.0E-23462521IPR009057Homeodomain-like
PROSITE profilePS5129424.561466522IPR017930Myb domain
SuperFamilySSF466892.43E-28468565IPR009057Homeodomain-like
SMARTSM007175.9E-13470520IPR001005SANT/Myb domain
PfamPF002493.1E-15471518IPR001005SANT/Myb domain
CDDcd001671.38E-10473518No hitNo description
Gene3DG3DSA:1.10.10.604.0E-23522573IPR009057Homeodomain-like
SMARTSM007171.0E-15523571IPR001005SANT/Myb domain
PROSITE profilePS5129419.448523573IPR017930Myb domain
PfamPF002494.2E-14524569IPR001005SANT/Myb domain
CDDcd001676.25E-11526569No hitNo description
ProDomPD3156571.0E-17830885IPR020529Origin recognition complex, subunit 6, metazoa/plant
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006260Biological ProcessDNA replication
GO:0005664Cellular Componentnuclear origin of replication recognition complex
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 885 aa     Download sequence    Send to blast
MVPAVFCLAP PLGVTEMSFQ VVATWLSTAR QYATVPVPPR TGPGPWHGYA PLPYAAAHCG  60
SRRRRRPSTL QGALEQCGRA HEREYPAEHC NECVCRINAF AMALGSCRAA ALWRVRLGET  120
GDVSTWSPES SSDYPRRETP RSAGRDGLRA TLRFGSRLRS NPFRRMISYN VEAMTVDRPN  180
DRGMAWHWHS MFIDAAHQTL NAKRHDLSIH IPVPASAILL LYSCPVGRGH CVDFRLVTTP  240
LLLRFDFYVV RCRCRCRTMH AHSTDTALSL SRWNLSVGCT GKITFMALGP GNLSVDYPAP  300
LLWPLPPRAT HPQRLNAKDA ASSHGAALRH RTALELSWLV ILGLLAIAQR ERDRLTLDGN  360
RRAFVRLTSV RRSRSSSKVS AVVWPRPETG VSVYKHANNS RVATLNRGHH DSHSRERKIL  420
FSQLWLITHQ FHAHFQSRAC RAKIQQKGSL LDRPPSTMGR PPCCDKEGVK KGPWTPEEDL  480
VLVSYLQEHG PGNWRAVPAR TGLMRCSKSC RLRWTNYLRP GINRGNFTDQ EEKLIVHLQA  540
LLGNRWAAIA SYLPERTDND IKNFWNTHLK RKLQSTGGDA AAKPTAHRPL ASSKGHWERR  600
LQTDINMARR ALREALTPLD DVVKTPQPDA AGAETGGDVD NPAPCSSGAS QWFPSTASAP  660
YVLTTENISR MLDCWSASGK GRRGGSGKGT PSGEESASGS SDASEVSYGG AVALDTGHLF  720
EYETKPAVPA QQTQLSAIES WLFEDDSNFH HVQSASLLDA AMDYPHRIPT SRHSPRSPKQ  780
SRNRSDRRSY FILPSKDAQA SPSLIPDLLL TETESPAAMD MSVIAARLGL CDVTFESSVL  840
GIGEVCKAII CLEIAASKTT LDVRELGIQF GCVRRIPLVQ KGLAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-244715734105MYB PROTO-ONCOGENE PROTEIN
1h88_C4e-2447157358159MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-2447157358159MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-244715734105C-Myb DNA-Binding Domain
1msf_C1e-244715734105C-Myb DNA-Binding Domain
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296